PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c7_16800V3.4.p
Common NamePHYPADRAFT_64527
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 2208aa    MW: 243536 Da    PI: 6.43
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c7_16800V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.33.6e-089621003346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                         +WT+ E +++v+ ++++ ++ +k Ia++++  +t  +c+++++ 
  Pp3c7_16800V3.4.p  962 PWTEVEKKIFVEKFALHYKN-FKEIASHLQ-YKTTADCIEYYYR 1003
                         8*****************99.*********.9**********96 PP

2Myb_DNA-binding38.23.4e-1211881230347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                          WT eE el+  av+ +G++ +++Ia+++g  ++  qcks++ k 
  Pp3c7_16800V3.4.p 1188 QWTDEERELFTSAVATHGKD-FRLIAAHVG-SKSQSQCKSFFSKT 1230
                         6*****************99.*********.**********9886 PP

3Myb_DNA-binding301.2e-0915181559346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                         +WT+eE e+++   +++G++ W++  + ++  ++l q+k ++q+
  Pp3c7_16800V3.4.p 1518 SWTQEEKEKFAVILQEHGKD-WTLLHQSLP-SKSLTQIKTYFQN 1559
                         7*****************99.*********.************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.94E-119471008IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-49561004IPR009057Homeodomain-like
PROSITE profilePS5129315.0089581009IPR017884SANT domain
SMARTSM007174.7E-99591007IPR001005SANT/Myb domain
PfamPF002495.0E-69611003IPR001005SANT/Myb domain
CDDcd001677.88E-79621004No hitNo description
SuperFamilySSF466895.24E-1211751236IPR009057Homeodomain-like
PROSITE profilePS5129317.43611841235IPR017884SANT domain
SMARTSM007174.9E-1111851233IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-811871232IPR009057Homeodomain-like
PfamPF002492.3E-1011881229IPR001005SANT/Myb domain
CDDcd001677.86E-811891227No hitNo description
Gene3DG3DSA:1.10.10.604.1E-715111562IPR009057Homeodomain-like
SuperFamilySSF466892.73E-1015131563IPR009057Homeodomain-like
PROSITE profilePS5129310.5415141565IPR017884SANT domain
SMARTSM007173.0E-815151563IPR001005SANT/Myb domain
PfamPF002497.2E-815181559IPR001005SANT/Myb domain
CDDcd001671.06E-515181561No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 2208 aa     Download sequence    Send to blast
MDKEVKEVLQ SQVIALKEGK MEASLQCLSP LVQPAPRYES SSDRVHLPAT MHSVMAETTN  60
DAEDRFTRPR SASFASSVQP KSANITRTEP PIDRKTIRHI GRFEVRRGRF DNWDDHDGEN  120
LSWLSSTRDL RNSDEARRGK DDRVLGRSDD IDRKEERGLR RLDERSERDE MRRVRSDVFG  180
EVSSVRGLTI MDEQERDRDR EYRQDGGSGE GVGRMMQRKP SFSGPMAQFG SGKGWGVGDK  240
KSELSRFERY GTGNRDGSRA EYEGNSRDLG FPYGWRRERS QSSAIARHSS FTSGNRSFGE  300
HGGKGSLSVS SGHDSPFVTG LSSNQDSDHP SPSKRPRLGW GQGLAKYEKK VGDTEDVSPS  360
VVRFDSKKDG DGEIHSNAEE VKKGNVSHEK LPEATPSGVS SSDLQKPCPM VGIQPEDGEG  420
FSDGLEKREK NENKSFLWRD HVRREESGEN SNSCALLGII PRIGDVKNPV VTEEMQRLEQ  480
IPASPVRMKD SANSTEEQKN ESKCPLSNGI EEPELNGLDP VSHVLVEDSE SREKNDEVTA  540
SELQESESLG RKNQSLVPSV SKVEWDFKCS AHAKTTEVLG DSHQTGMLFT ETLPRSVDTV  600
IRPSCSELSL TLVPVRLNKS SICSEKDTIS TVALSRRTDG EDETILSRES VPIPIQEKAI  660
ELMPECVVPE SVNIGEKIKV EGVLELEPAR KLSKSMDLDE DEDVRGVPLE SADLNIDEGV  720
VVVSSRSSPL SAVSEKSSYY EEQSDYEVAT GGSSLQEHSL SMEESLMMEN KENARLAGAS  780
FLHLLPENLK REPYQQLYDS PTEALVWQHN VETHKKIEDM LLKKISEKHH FHKFKERILT  840
LRFIALKEAW KQEQKGLSGL RNRPKSVSRW DNEGRSSHGP PSQRFSLRLR PPSMNRLDSE  900
SDAAKAMKKL MKEPRVEALR PVLKMPAMIL DEKERASRRF VSRNALVEDP VTVEMERKTL  960
NPWTEVEKKI FVEKFALHYK NFKEIASHLQ YKTTADCIEY YYRNQKSESF SKSKEGGHSK  1020
SLGDRTKPST FLTPTAVAIK RNLKANCATV EALNVATMNM KVSQLSSQVS EHAKTMTSSN  1080
HSLSMPADAK IRKSHLKESK VLEVILPSGT SVETVTSSLI STPCSVSSTA VPLTDECKEK  1140
GFVKERVGRG PSATRSSHSE QHLAGPKSTR STYLRRMSSK AATQEGSQWT DEERELFTSA  1200
VATHGKDFRL IAAHVGSKSQ SQCKSFFSKT RKRLGLDELV EQFQANEAAA MLVQSFRHDA  1260
ELLQEVKQIS TAQNVQMDAS AGVVGHSVDE LSDTAAAVST LERLKEQSKC FANDMSDLSL  1320
VADAAAAMEE MSLMKSESPS RDFSNNKQLL EIAELAHEHL KVEPSNIAAI RQEGEDDSET  1380
TKSDDSCQVD TQAEIDIVVD QAAAALLGMS ETLVDNSGLK RSKSEAKVGT RTSPVSVFSR  1440
SQSARLSTSS PPLHAVFETN VCLTSGRNSR QAKERVNSTT SCKPTTRDRP QDMQDAQSGR  1500
KGKDTGGGEP KLRREPTSWT QEEKEKFAVI LQEHGKDWTL LHQSLPSKSL TQIKTYFQNS  1560
KARSRLPAVV KLMNVVRRDG GSRKRKAEGY ESSRKAAELG PPFKQKVRAN AASHEFDDTT  1620
QEEDNLFRSA SVSGGTGVGV DILAYAARFG TYPGQPINQD TLSMNGMQHL ARPMPTSNTY  1680
VQESKQDGHQ AFRSGARPVL PTPLGIRPHV GDGLLRQLSS SVPSKACSPD LQVLSSNVGP  1740
QAEPPAAIHQ VAQQVQQMLA QQQHLQKQLA LLIQQQAALP QALLPQHQQA TEQTLQSARP  1800
LEEKLQQVVQ QLQQQQALAQ SQEGEIHNHM HFQYQQAPHG RGILKVKPIR EAISNPFADL  1860
AILPSPDVLQ NQHISRNQEI QLQQQDHSLS LGMRTIPSTA GGSTAGLHEN HSKTLDLQDS  1920
DTDTDTDCEG MGSKQMVAED SHQRMSVVHS SSSGQQQGAA QSTTSTLSSD SEQVKSWDVK  1980
LFGQSLLSKP TALPSTMPRI TGSSIQEFVK PNISSPVATV TYPAGSLSKE FKPSESLPSA  2040
FGRVGASSSV AEGQPTSWAG MSSLLEKLGV YGAWSTTSSL QLSEVTELSR KEPDSEGTQD  2100
AVTSMPTIPD RQHTDNQDLV LTSEQGPQRD DGHHDGEREL SACQSETRGR ETTVEETPFL  2160
GRIQNCSSEN VVSLDAGQCQ IGLDSALPAS HMKSFPTVSA EPGHWGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D4e-179181010293NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C4e-179181010293NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.168350.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001751861.10.0predicted protein
TrEMBLA9RCH60.0A9RCH6_PHYPA; Predicted protein
STRINGPP1S2_775V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.13e-40MYB family protein
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]